USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
PDE3A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PDE3A antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (94%). |
PDE3A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PDE3A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Horse (83%). |
PDE3A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Mouse, Rat, Horse, Gibbon |
| Immunogen | PDE3A antibody was raised against synthetic 17 amino acid peptide from internal region of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Horse, Opossum (100%); Chicken (88%). |
Rabbit Polyclonal Anti-INSR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | INSR / Insulin Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human Insulin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Bovine, Dog, Elephant, Panda (94%); Bat, Horse, Pig (88%); Marmoset (81%). |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 428.00
2 Weeks
USD 180.00
2 Weeks
G6PC Rabbit monoclonal antibody,clone OTIR4H3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 428.00
2 Weeks
USD 180.00
2 Weeks
G6PC Rabbit monoclonal antibody,clone OTIR5G10
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 428.00
2 Weeks
USD 180.00
2 Weeks
G6PC Rabbit monoclonal antibody,clone OTIR2H10
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
