Antibodies

Jump to Filters
View as table Download
Jagged1 (JAG1) Rabbit Polyclonal Antibody
TA349128

USD 484.00

5 Days

Rabbit Polyclonal Anti-JAG1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen JAG1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human JAG1.
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 430.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
APH1A Rabbit Polyclonal Antibody
TA306378

USD 430.00

In Stock

Rabbit Polyclonal APH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APH1 antibody was raised against a 18 amino acid peptide from near the center of human APH1.
NOTCH2 Rabbit Polyclonal Antibody
TA311717

USD 345.00

In Stock

Rabbit polyclonal Notch 2 (Cleaved-Asp1733) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 2.
DLL4 Rabbit Polyclonal Antibody
TA319489

USD 530.00

2 Weeks

Rabbit polyclonal anti-DELTA-4 antibody

Applications IHC, WB
Reactivities Human, partial reactivity to Mouse and Rat
Conjugation Unconjugated
Immunogen Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4.
PEN2 (PSENEN) Rabbit Polyclonal Antibody
TA306368

USD 430.00

5 Days

Rabbit Polyclonal PEN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2.
Nicastrin (NCSTN) Rabbit Polyclonal Antibody
TA306369

USD 430.00

5 Days

Rabbit Polyclonal Nicastrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nicastrin antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human Nicastrin.
Nicastrin (NCSTN) Rabbit Polyclonal Antibody
TA306370

USD 430.00

5 Days

Rabbit Polyclonal Nicastrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nicastrin antibody was raised against a 18 amino acid peptide from near the center of human Nicastrin.
APH1A Goat Polyclonal Antibody
TA303251

USD 375.00

5 Days

Goat Polyclonal Antibody against APH1A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVTDRSDARLQYG, from the internal region of the protein sequence according to NP_001071096.1; NP_057106.2.
Jagged1 (JAG1) Goat Polyclonal Antibody
TA326300

USD 375.00

5 Days

Goat Anti-JAG1 Antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TNKQDNRDLESAQS, from the C Terminus of the protein sequence according to NP_000205.1.
Presenilin 2 (PSEN2) Rabbit Polyclonal Antibody
TA335237

USD 375.00

5 Days

Rabbit Polyclonal Anti-PSEN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN2 antibody: synthetic peptide directed towards the N terminal of human PSEN2. Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
Jagged1 (JAG1) Mouse Monoclonal Antibody [Clone ID: OTI3A10]
CF807944

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) JAG1 mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ADAM17 Rabbit Polyclonal Antibody
TA321563

USD 345.00

In Stock

Anti-ADAM17 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
NOTCH2 Rabbit Polyclonal Antibody
TA322182

USD 345.00

In Stock

Anti-NOTCH2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from C'13aa amino acids of human notch 2
Nicastrin (NCSTN) Rabbit Polyclonal Antibody
TA350228

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-NCSTN Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NCSTN
Jagged1 (JAG1) Rabbit Polyclonal Antibody
TA351307

USD 345.00

In Stock

Rabbit Polyclonal Anti-JAG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human JAG1
Jagged1 (JAG1) Mouse Monoclonal Antibody [Clone ID: OTI3A10]
TA807944

USD 379.00

In Stock

JAG1 mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Jagged1 (JAG1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A10]
TA807944AM

USD 420.00

4 Weeks

JAG1 mouse monoclonal antibody, clone OTI3A10 (formerly 3A10), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Jagged1 (JAG1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A10]
TA807944BM

USD 420.00

4 Weeks

JAG1 mouse monoclonal antibody, clone OTI3A10 (formerly 3A10), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Jagged1 (JAG1) Mouse Monoclonal Antibody [Clone ID: OTI3A10]
TA807944S

USD 159.00

2 Days

JAG1 mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".