FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit Polyclonal Anti-UBE2J2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody,clone OTI3D5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI6F5 (formerly 6F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI10B9 (formerly 10B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FBXW7 mouse monoclonal antibody, clone OTI13H4 (formerly 13H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SYVN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human synovial apoptosis inhibitor 1, synoviolin |
Rabbit Polyclonal Anti-FBXW7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBXW7 |
UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3C11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3C11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3E6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3E6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1F6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1F6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3D1, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3D1, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody,clone OTI3D5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3D5, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 3D5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody,clone OTI3D5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1C7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
UBE2J1 mouse monoclonal antibody,clone 1C7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UBE2J1 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FBXW7 mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FBXW7 mouse monoclonal antibody,clone 2G7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FBXW7 mouse monoclonal antibody,clone 2G7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FBXW7 mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FBXW7 mouse monoclonal antibody, clone OTI6F5 (formerly 6F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FBXW7 mouse monoclonal antibody,clone 6F5, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
FBXW7 mouse monoclonal antibody,clone 6F5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FBXW7 mouse monoclonal antibody, clone OTI6F5 (formerly 6F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FBXW7 mouse monoclonal antibody, clone OTI10B9 (formerly 10B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
FBXW7 mouse monoclonal antibody, clone OTI10B9 (formerly 10B9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |