Germany
Japan
United Kingdom
China
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Goat Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |
Rabbit Polyclonal Antibody against ALDH6A1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1. |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
USD 465.00
4 Weeks
Anti-ALDH6A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1 |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ALDH3A2 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | FC, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Applications
- IHC
Families
- Transmembrane
Pathways
- leucine and isoleucine degradation