Antibodies

View as table Download

Mouse Monoclonal TLR9 Antibody (26C593.2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal GRAIL/RNF128 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1.

Rabbit Polyclonal CXCR7/RDC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1.