Antibodies

View as table Download

Rabbit Polyclonal Anti-BACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Rabbit Polyclonal Anti-BACE1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen BACE1 / BACE antibody was raised against synthetic 15 amino acid peptide from internal region of human BACE1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Guinea pig (100%); Platypus (87%); Xenopus, Pufferfish, Zebrafish, Stickleback (80%).

Rabbit Polyclonal Anti-BACE1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen BACE1 / BACE antibody was raised against synthetic 18 amino acid peptide from C-terminus of human BACE1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Guinea pig (94%); Opossum (89%); Turkey, Chicken, Platypus (83%).

Anti-BACE1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human beta-site APP-cleaving enzyme 1