BACE1 Rabbit Polyclonal Antibody

CAT#: TA341892

Rabbit Polyclonal Anti-BACE1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Other products for "BACE1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name beta-secretase 1
Background Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which isThe protein encoded byThis gene.The encoded protein, a member ofThe peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly inThe Golgi. Multiple transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, May 2011]
Synonyms ASP2; BACE; HSPC104
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.