Antibodies

View as table Download

Rabbit Polyclonal Anti-GCNT3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

Rabbit polyclonal anti-GCNT3 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GCNT3.

GCNT3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 390-418 amino acids from the C-terminal region of Human GCNT3

Rabbit Polyclonal Anti-GCNT3 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GCNT3 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human GCNT3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (93%); Marmoset (80%).

Rabbit Polyclonal Anti-GCNT3 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen GCNT3 antibody was raised against synthetic 16 amino acid peptide from internal region of human GCNT3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Chimpanzee, Orangutan, Gibbon (94%); Marmoset (88%); Monkey (81%).

Rabbit Polyclonal Anti-GCNT3 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen GCNT3 antibody was raised against synthetic 15 amino acid peptide from internal region of human GCNT3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda, Horse (100%); Marmoset, Sheep, Bovine, Pig (93%); Hamster, Rabbit, Platypus, Xenopus (80%).

Rabbit Polyclonal Anti-GCNT3 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen GCNT3 antibody was raised against synthetic 16 amino acid peptide from internal region of human GCNT3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Orangutan (94%); Chimpanzee, Gibbon, Monkey, Galago (88%); Marmoset, Pig (81%).