Antibodies

Jump to Filters
View as table Download
beta 1 Sodium Potassium ATPase (ATP1B1) Rabbit Polyclonal Antibody
TA332918

USD 275.00

3 Weeks

Rabbit anti-ATP1B1 Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATP1B1
beta 1 Sodium Potassium ATPase (ATP1B1) Rabbit Polyclonal Antibody
TA335284

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP1B1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL