Antibodies

Jump to Filters
View as table Download
CLOCK Rabbit Polyclonal Antibody
TA312928

USD 345.00

In Stock

Rabbit polyclonal anti-Clock antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Clock.
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA329741

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA349647

USD 345.00

In Stock

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
Casein Kinase 1 delta (CSNK1D) Rabbit Polyclonal Antibody
TA349833

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D
NR1D1 Rabbit Polyclonal Antibody
TA350237

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR1D1