Antibodies

View as table Download

Rabbit Polyclonal Antibody against MOP3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human MOP3 (C-terminus).

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF