Antibodies

Jump to Filters
View as table Download
ZNFN1A2 (IKZF2) Rabbit Polyclonal Antibody
TA349148

USD 484.00

2 Weeks

Rabbit Polyclonal Anti-IKZF2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IKZF2 antibody was raised against a 19 amino acid peptide near the amino terminus of human IKZF2.
ZNFN1A2 (IKZF2) Rabbit Polyclonal Antibody
TA329380

USD 310.00

5 Days

Rabbit Polyclonal anti-ZNFN1A2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNFN1A2 antibody: synthetic peptide directed towards the C terminal of human ZNFN1A2. Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD
IKZF2 Rabbit Polyclonal Antibody
TA370655

USD 380.00

4 Weeks

IKZF2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IKZF2