Rabbit Polyclonal Anti-IKZF2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IKZF2 antibody was raised against a 19 amino acid peptide near the amino terminus of human IKZF2. |
Rabbit Polyclonal Anti-IKZF2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IKZF2 antibody was raised against a 19 amino acid peptide near the amino terminus of human IKZF2. |
Rabbit Polyclonal anti-ZNFN1A2 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNFN1A2 antibody: synthetic peptide directed towards the C terminal of human ZNFN1A2. Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD |
IKZF2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IKZF2 |