ZNFN1A2 (IKZF2) Rabbit Polyclonal Antibody

CAT#: TA329380

Rabbit Polyclonal anti-ZNFN1A2 antibody

Product Images

WB Suggested Anti-ZNFN1A2 Antibody Titration: 5.0ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNFN1A2 antibody: synthetic peptide directed towards the C terminal of human ZNFN1A2. Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: IKAROS family zinc finger 2
• Database Link:
  NP_001072994
  Entrez Gene 22807 Human
  UniProt ID Q9UKS7
• Background: Novel short isoforms of this gene, ZNFN1A2, are overexpressed in a patient with T-cell acute lymphoblastic leukemia and may contribute to the development of T-cell malignancies.
• Synonyms: ANF1A2; HELIOS; ZNF1A2; ZNFN1A2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%