Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IKZF2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IKZF2 antibody: synthetic peptide directed towards the middle region of human IKZF2. Synthetic peptide located within the following region: EREASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKAL |
Rabbit Polyclonal Anti-LSD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LSD1 antibody was raised against a 19 amino acid peptide near the amino terminus of human LSD1. |
Rabbit polyclonal anti-IKZF2 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IKZF2. |
Rabbit Polyclonal anti-ZNFN1A2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNFN1A2 antibody: synthetic peptide directed towards the C terminal of human ZNFN1A2. Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD |
IKZF2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IKZF2 |
IKZF2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IKZF2 |
IKZF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-440 of human IKZF2 (NP_001072994.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IKZF2