Antibodies

Jump to Filters
View as table Download
PHF17 (JADE1) Rabbit Polyclonal Antibody
TA337306

USD 375.00

5 Days

Rabbit Polyclonal Anti-PHF17 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the C terminal of human PHF17. Synthetic peptide located within the following region: YQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLE
JADE1 Rabbit Polyclonal Antibody
TA366663

USD 380.00

4 Weeks

JADE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human JADE1
JADE1 Rabbit Polyclonal Antibody
TA371014

USD 380.00

4 Weeks

JADE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human JADE1