PHF17 (JADE1) Rabbit Polyclonal Antibody

CAT#: TA337306

Rabbit Polyclonal Anti-PHF17 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "JADE1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the C terminal of human PHF17. Synthetic peptide located within the following region: YQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name jade family PHD finger 1
Background PHF17 belongs to the JADE family. It contains 2 PHD-type zinc fingers. PHF17 is a transcriptional coactivator which seems to act by promoting acetylation of nucleosomal histone H4 by HTATIP. PHF17 promotes apoptosis. Itmay act as a renal tumor suppressor.
Synonyms PHF17
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.