Antibodies

View as table Download

c-Myb (MYB) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide from human MYB (aa1-50). 
aa1-50

Rabbit polyclonal Myb (Phospho-Ser532) antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T).
Modifications Phospho-specific

Goat Polyclonal Antibody against MYB / c-myb

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRHYNDEDPEKEKR, from the internal region of the protein sequence according to NP_005366.2.

Rabbit Polyclonal Anti-MYB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYB antibody: synthetic peptide directed towards the N terminal of human MYB. Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD

c-Myb (MYB) (241-254) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Canine, Equine, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from positions 241-254 of human MYB (NP_001123645.1)

Rabbit Polyclonal Anti-MYB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MYB

Phospho-c Myb (Ser11) Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Myb (Phosphorylated)