Antibodies

Jump to Filters
View as table Download
NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody
TA341801

USD 375.00

5 Days

Rabbit Polyclonal Anti-NKX2-3 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Nkx2-3 antibody: synthetic peptide directed towards the c terminal of mouse Nkx2-3. Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG