NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody

CAT#: TA341801

Rabbit Polyclonal Anti-NKX2-3 Antibody

Product Images

WB Suggested Anti-Nkx2-3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Mouse Uterus

• 

  IHC Information: Paraffin embedded mouse lymphoid tissue (skeletal muscle) tissue, tested with an antibody dilution of 5 ug/ml.

• 

  IHC Information: Paraffin embedded spleenlympho tissue, tested with an antibody dilution of 5 ug/ml.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nkx2-3 antibody: synthetic peptide directed towards the c terminal of mouse Nkx2-3. Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: NK2 homeobox 3
• Database Link:
  NP_660328
  Entrez Gene 18089 Mouse
  UniProt ID Q8TAU0
• Background: Nkx2-3 is a transcriptional regulator essential for normal development and functions ofThe small intestine and spleen.Nkx2-3 activates directly MADCAM1 expression.Nkx2-3 is required for homing of lymphocytes in spleen and mucosa-associated lymphoid tissue. Nkx2-3 may have a role during pharyngeal organogenesis.
• Synonyms: CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 87%; Human: 87%; Bovine: 87%; Guinea pig: 87%

Reference Data

• Protein Families: Transcription Factors