NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody
Other products for "NKX2-3"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Nkx2-3 antibody: synthetic peptide directed towards the c terminal of mouse Nkx2-3. Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 38 kDa |
| Gene Name | NK2 homeobox 3 |
| Database Link | |
| Background | Nkx2-3 is a transcriptional regulator essential for normal development and functions ofThe small intestine and spleen.Nkx2-3 activates directly MADCAM1 expression.Nkx2-3 is required for homing of lymphocytes in spleen and mucosa-associated lymphoid tissue. Nkx2-3 may have a role during pharyngeal organogenesis. |
| Synonyms | CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3 |
| Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 87%; Human: 87%; Bovine: 87%; Guinea pig: 87% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China