Antibodies

Jump to Filters
View as table Download
TRIP13 Rabbit Polyclonal Antibody
TA339092

USD 310.00

5 Days

Rabbit Polyclonal Anti-TRIP13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the N terminal of human TRIP13. Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF