TRIP13 Rabbit Polyclonal Antibody

CAT#: TA339092

Rabbit Polyclonal Anti-TRIP13 Antibody

Product Images

WB Suggested Anti-TRIP13 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysate TRIP13 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-TRIP13 antibody; Paraffin Embedded Tissue: Human Heart cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the N terminal of human TRIP13. Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: thyroid hormone receptor interactor 13
• Database Link:
  NP_004228
  Entrez Gene 9319 Human
  UniProt ID Q15645
• Background: This gene encodes a protein that interacts with thyroid hormone receptors, also known as hormone-dependent transcription factors. The gene product interacts specifically with the ligand binding domain. This gene is one of several that may play a role in early-stage non-small cell lung cancer. [provided by RefSeq, Oct 2009]
• Synonyms: 16E1BP
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors