Antibodies

Jump to Filters
View as table Download
TCF7 (617-631) Goat Polyclonal Antibody
AP23981PU-N

USD 440.00

2 Weeks

TCF7 (617-631) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Canine, Equine, Hamster, Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide from positions 617-631 of human TCF1 (NP_000536.5)
TCF7 Rabbit Polyclonal Antibody
TA338240

USD 375.00

5 Days

Rabbit Polyclonal Anti-TCF7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM