Antibodies

Jump to Filters
View as table Download
ACTN3 (N-term) Rabbit Polyclonal Antibody
AP23644PU-N

USD 440.00

2 Weeks

ACTN3 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ACTN3 antibody was raised against synthetic peptide - KLH conjugated
ACTN3 Rabbit Polyclonal Antibody
TA346275

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACTN3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY
ACTN3 (Center) Rabbit Polyclonal Antibody
AP50072PU-N

USD 450.00

2 Weeks

ACTN3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 408-437 amino acids from the Central region of human ACTN3