Antibodies

Jump to Filters
View as table Download
ASS1 Rabbit Polyclonal Antibody
TA346025

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
ASS1 Rabbit Polyclonal Antibody
TA346024

USD 410.00

5 Days

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
ASS1 Rabbit Polyclonal Antibody
TA308171

USD 415.00

In Stock

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)
ASS1 (196-212) Goat Polyclonal Antibody
AP23046PU-N

USD 440.00

2 Weeks

ASS1 (196-212) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from an internal region of human ASS1
ASS1 (C-term) Rabbit Polyclonal Antibody
AP50278PU-N

USD 450.00

2 Weeks

ASS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 280-310 amino acids from the C-terminal region of human ASS1
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI3D1]
CF809168

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI8H4]
CF809170

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI12G1]
CF809216

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI3D1]
TA809168

USD 379.00

In Stock

ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI3D1]
TA809168S

USD 159.00

2 Days

ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ASS1 Mouse Monoclonal Antibody [Clone ID: OTI8H4]
TA809170

USD 379.00

In Stock

ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI8H4]
TA809170S

USD 159.00

2 Days

ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ASS1 Mouse Monoclonal Antibody [Clone ID: OTI12G1]
TA809216

USD 379.00

In Stock

ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI12G1]
TA809216S

USD 159.00

2 Days

ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".