Antibodies

Jump to Filters
View as table Download
GLS2 Rabbit Polyclonal Antibody
TA319893

USD 430.00

2 Weeks

Rabbit Polyclonal GLS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2.
GLS2 Rabbit Polyclonal Antibody
TA336821

USD 479.00

5 Days

Rabbit Polyclonal GLS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399).
GLS2 Rabbit Polyclonal Antibody
TA331991

USD 310.00

5 Days

Rabbit Polyclonal Anti-GLS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
CF809492

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI4C10]
CF809494

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
TA809492

USD 379.00

In Stock

GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI4C10]
TA809494

USD 379.00

In Stock

GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI4C10]
TA809494S

USD 159.00

2 Days

GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".