Antibodies

Jump to Filters
View as table Download
SLIT1 Rabbit Polyclonal Antibody
TA344212

USD 475.00

5 Days

Rabbit Polyclonal Anti-SLIT1 Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLIT1 antibody: synthetic peptide directed towards the middle region of human SLIT1. Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
SLIT1 Rabbit Polyclonal Antibody
TA351719

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLIT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLIT1