Antibodies

Jump to Filters
View as table Download
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA329901

USD 375.00

5 Days

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7C7]
CF806789

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF806791

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2E11]
CF806917

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA350653

USD 345.00

In Stock

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DVL2
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7C7]
TA806789S

USD 159.00

2 Days

DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA806791S

USD 159.00

2 Days

DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2E11]
TA806917S

USD 159.00

2 Days

DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".