Antibodies

Jump to Filters
View as table Download
DP2 (TFDP2) Rabbit Polyclonal Antibody
TA333923

USD 310.00

5 Days

Rabbit Polyclonal Anti-TFDP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TFDP2 Antibody: synthetic peptide directed towards the N terminal of human TFDP2. Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF
DP2 (TFDP2) Rabbit Polyclonal Antibody
TA350489

USD 345.00

In Stock

Rabbit Polyclonal Anti-TFDP2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein