Antibodies

Jump to Filters
View as table Download
PCK1 Rabbit Polyclonal Antibody
TA590679

USD 409.00

In Stock

Rabbit Polyclonal PCK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
PCK1 Rabbit Polyclonal Antibody
TA331175

USD 310.00

5 Days

Rabbit Polyclonal Anti-PCK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
PCK1 (513-524) Goat Polyclonal Antibody
AP22519PU-N

USD 440.00

2 Weeks

PCK1 (513-524) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bat, Canine, Equine, Human, Monkey, Rabbit
Immunogen Synthetic peptide from an internal region of human PCK1
PCK1 Goat Polyclonal Antibody
TA305772

USD 375.00

5 Days

Goat Anti-PCK1 / PEPCKC (internal) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3.