Antibodies

Jump to Filters
View as table Download
Glutathione S Transferase theta 1 (GSTT1) Rabbit Polyclonal Antibody
TA327030

USD 275.00

In Stock

GSTT1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTT1
Glutathione S Transferase theta 1 (GSTT1) Rabbit Polyclonal Antibody
TA346677

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Glutathione S Transferase theta 1 (GSTT1) Rabbit Polyclonal Antibody
TA308416

USD 415.00

5 Days

Rabbit polyclonal antibody to GSTT1 (glutathione S-transferase theta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 240 of GSTT1 (Uniprot ID#P30711)