Antibodies

Jump to Filters
View as table Download
GJD2 Rabbit Polyclonal Antibody
TA341671

USD 375.00

5 Days

Rabbit Polyclonal Anti-GJD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJD2 antibody: synthetic peptide directed towards the middle region of human GJD2. Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
GJD2 Rabbit Polyclonal Antibody
TA322251

USD 345.00

In Stock

Anti-GJD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 157-175 amino acids of Human gap junction protein, delta 2, 36kDa