Antibodies

Jump to Filters
View as table Download
GnRH (GNRH1) Rabbit Polyclonal Antibody
TA349380

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GNRH1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNRH1
GnRH (GNRH1) Rabbit Polyclonal Antibody
20075

USD 360.00

3 Days

GnRH (GNRH1) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated
GnRH (GNRH1) Rabbit Polyclonal Antibody
TA358540

USD 360.00

5 Days

GNRH1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS