GnRH (GNRH1) Rabbit Polyclonal Antibody

CAT#: TA358540

GNRH1 Antibody

Product Images

Rabbit Anti-GNRH1 antibody Catalog Number: ARP63800 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS
• Specificity: Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
  Homology: Cow: 93%; Dog: 92%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 92%; Sheep: 86%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 10 kDa
• Gene Name: gonadotropin releasing hormone 1
• Database Link:
  NP_000816
  Entrez Gene 2796 Human
  UniProt ID P01148
• Background: The protein encoded by this gene is secreted and then cleaved to form the 10 aa luteinizing hormone-releasing hormone (LHRH, also known as gonadoliberin-1), and prolactin release-inhibiting factor (also known as GnRH-associated peptide 1). LHRH stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutation in this gene are associated with hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been described for this gene.
• Synonyms: GNRH; GRH; LHRH; LNRH

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: GnRH signaling pathway