Rabbit Polyclonal Anti-RAD54B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV |
Rabbit Polyclonal Anti-RAD54B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the middle region of human RAD54B. Synthetic peptide located within the following region: NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT |
Rabbit polyclonal anti-RAD54B antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD54B. |
Germany
Japan
United Kingdom
China
