Antibodies

Jump to Filters
View as table Download
PIAS3 Rabbit Polyclonal Antibody
TA319815

USD 430.00

In Stock

Rabbit Polyclonal PIAS3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS3 antibody was raised against a 12 amino acid synthetic peptide near the carboxy terminus of human PIAS3.
PIAS3 Rabbit Polyclonal Antibody
TA326269

USD 345.00

In Stock

Rabbit polyclonal PIAS3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS3.
PIAS3 (C-term) Rabbit Polyclonal Antibody
AP23956PU-N

USD 440.00

2 Weeks

PIAS3 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PIAS3 antibody was raised against synthetic peptide - KLH conjugated
PIAS3 Rabbit Polyclonal Antibody
TA331150

USD 310.00

5 Days

Rabbit Polyclonal Anti-PIAS3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS3 antibody: synthetic peptide directed towards the C terminal of human PIAS3. Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV