PIAS3 Rabbit Polyclonal Antibody

CAT#: TA331150

Rabbit Polyclonal Anti-PIAS3 Antibody

Product Images

WB Suggested Anti-PIAS3 Antibody Titration: 1.0-2.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIAS3 antibody: synthetic peptide directed towards the C terminal of human PIAS3. Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: protein inhibitor of activated STAT 3
• Database Link:
  NP_006090
  Entrez Gene 10401 Human
  UniProt ID Q9Y6X2
• Background: PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses.
• Synonyms: ZMIZ5
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Jak-STAT signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis