Antibodies

Jump to Filters
View as table Download
ACTN2 Rabbit Polyclonal Antibody
TA346070

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH
ACTN2 Rabbit Polyclonal Antibody
TA346071

USD 410.00

5 Days

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD
ACTN2 Rabbit Polyclonal Antibody
TA311680

USD 345.00

In Stock

Rabbit polyclonal Actinin alpha-2/3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Actinin a-2/3.
ACTN2 (11-347) Rabbit Polyclonal Antibody
AP23169PU-N

USD 440.00

2 Weeks

ACTN2 (11-347) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 11 and 347 of alpha Actinin 2
ACTN2 (215-500) Rabbit Polyclonal Antibody
AP23620PU-N

USD 440.00

2 Weeks

ACTN2 (215-500) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 215 and 500 of actinin, alpha 2
ACTN2 Rabbit Polyclonal Antibody
TA351625

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTN2