Antibodies

View as table Download

Rabbit Polyclonal Anti-AMACR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AMACR

AMACR (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 330-359 amino acids from the C-terminal region of human AMACR

Rabbit Polyclonal Anti-AMACR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone OTI2A11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone OTI5F10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone OTI2A11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone OTI2A11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone OTI5F10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone OTI5F10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone UMAB68

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone UMAB68

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone UMAB214

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone UMAB214

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone UMAB215

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone UMAB215

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone UMAB68

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone UMAB214

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone UMAB215

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated