Antibodies

View as table Download

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody,clone OTI3E6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated