Antibodies

Jump to Filters
View as table Download
EGR1 Rabbit Polyclonal Antibody
TA319423

USD 530.00

5 Days

Rabbit polyclonal anti-EGR-1 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human, Mouse
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1.
EGR1 Rabbit Polyclonal Antibody
TA330209

USD 375.00

5 Days

Rabbit Polyclonal Anti-EGR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of human EGR1. Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS