EGR1 Rabbit Polyclonal Antibody

CAT#: TA330209

Rabbit Polyclonal Anti-EGR1 Antibody

Product Images

WB Suggested Anti-EGR1 Antibody Titration: 1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Rabbit Anti-EGR1 Antibody; Paraffin Embedded Tissue: Human Spleen; Cellular Data: Spleen cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-EGR1 Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Immunohistochemistry with Colon, myenteric plexus tissue at an antibody concentration of 5.0 ug/ml using anti-EGR1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of human EGR1. Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: early growth response 1
• Database Link:
  NP_001955
  Entrez Gene 1958 Human
  UniProt ID P18146
• Background: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: AT225; G0S30; KROX-24; NGFI-A; TIS8; ZIF-268; ZNF225
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Bovine: 87%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Prion diseases