Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 4 of 4 results

(reset)

alpha Actinin 4 (ACTN4) Rabbit Polyclonal Antibody

TA346384

USD 410.00

5 Days

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

1 / 3

2 / 3

3 / 3

Previous Next

alpha Actinin 4 (ACTN4) Rabbit Polyclonal Antibody

TA308476

USD 415.00

5 Days

Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707)

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

alpha Actinin 4 (ACTN4) Mouse Monoclonal Antibody [Clone ID: 4D10]

AM31143PU-N

USD 480.00

2 Weeks

alpha Actinin 4 (ACTN4) mouse monoclonal antibody, clone 4D10, Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Mouse, Rat

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

alpha Actinin 4 (ACTN4) Rabbit Polyclonal Antibody

TA349672

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human ACTN4

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

1 - 4 of 4 results