ERCC8 (106-300) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Recombinant protein fragment corresponding to a region within amino acids 106 and 300 of CSA |
ERCC8 (106-300) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Recombinant protein fragment corresponding to a region within amino acids 106 and 300 of CSA |
ERCC8 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 210-238 amino acids from the Central region of Human ERCC8 |
Rabbit Polyclonal anti-ERCC8 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Carrier-free (BSA/glycerol-free) ERCC8 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERCC8 mouse monoclonal antibody,clone OTI5C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERCC8 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERCC8 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERCC8 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ERCC8 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERCC8 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ERCC8 mouse monoclonal antibody,clone OTI5C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERCC8 mouse monoclonal antibody,clone OTI5C9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ERCC8 mouse monoclonal antibody,clone OTI5C9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERCC8 mouse monoclonal antibody,clone OTI5C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ERCC8 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERCC8 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ERCC8 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERCC8 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".