Antibodies

Jump to Filters
View as table Download
NFATC4 Rabbit Polyclonal Antibody
AP21053PU-N

USD 407.00

2 Weeks

NFATC4 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 635-689 of Human NFATc4.
NFATC4 Rabbit Polyclonal Antibody
TA311635

USD 345.00

In Stock

Rabbit polyclonal NFAT3 (Ab-676) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T).
NFATC4 Goat Polyclonal Antibody
AP31861PU-N

USD 375.00

5 Days

NFATC4 goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Human, Mouse, Porcine, Rat
Immunogen Peptide with sequence from the C Terminus of the protein sequence according to NP_004545.2, NP_001185894.1, NP_001185895.1, NP_001185896.1.
NFATC4 Rabbit Polyclonal Antibody
TA331121

USD 310.00

5 Days

Rabbit Polyclonal Anti-NFATC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the middle region of human NFATC4. Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV
NFATC4 Rabbit Polyclonal Antibody
TA323877

USD 345.00

In Stock

Anti-NFATC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4