Antibodies

View as table Download

SPSB2 mouse monoclonal antibody, clone 1E6

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-SPSB2 Antibody

Applications IHC, WB
Reactivities Human, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the N terminal of human SPSB2. Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR

Rabbit Polyclonal Anti-SPSB2 Antibody

Applications IHC, WB
Reactivities Human, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the C terminal of human SPSB2. Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG

SPSB2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SPSB2