Rabbit Polyclonal USP9x Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Genomic peptide made to an internal region of the human Usp9X protein (within residues 1150-1300). [Swiss-Prot Q93008] |
Rabbit Polyclonal USP9x Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Genomic peptide made to an internal region of the human Usp9X protein (within residues 1150-1300). [Swiss-Prot Q93008] |
Rabbit Polyclonal Anti-USP9X Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP9X antibody: synthetic peptide directed towards the C terminal of human USP9X. Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ |
USP9X (2479-2492) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Monkey |
Immunogen | USP9X antibody was raised against synthetic peptide from the C-terminus (near) of human USP9X (NP_001034679.2). |
Carrier-free (BSA/glycerol-free) USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-USP9X Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human USP9X |
USP9X rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human USP9X |
USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USP9X mouse monoclonal antibody,clone 2G7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USP9X mouse monoclonal antibody,clone 2G7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |