KCNN2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNN2 |
KCNN2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNN2 |
Rabbit polyclonal Anti-KCa2.2 (SK2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)ETQMENYDKHVTYNAERS, corresponding to amino acid residues 542-559 of rat KCa2.2. Intracellular, C-terminal part. |
Rabbit Polyclonal Anti-KCNN2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Rhesus macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
KCNN2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNN2 |