Antibodies

Jump to Filters
View as table Download
POFUT2 Rabbit Polyclonal Antibody
TA338933

USD 310.00

5 Days

Rabbit Polyclonal Anti-POFUT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POFUT2 antibody: synthetic peptide directed towards the C terminal of human POFUT2. Synthetic peptide located within the following region: RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP