POFUT2 Rabbit Polyclonal Antibody

CAT#: TA338933

Rabbit Polyclonal Anti-POFUT2 Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: HepG2.There is BioGPS gene expression data showing that POFUT2 is expressed in HepG2

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POFUT2 antibody: synthetic peptide directed towards the C terminal of human POFUT2. Synthetic peptide located within the following region: RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: protein O-fucosyltransferase 2
• Database Link:
  NP_056042
  Entrez Gene 23275 Human
  UniProt ID Q9Y2G5
• Background: Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (3) differs in the 3' UTR and coding region compared to variant 1. The resulting isoform (C) is longer and differs in the C-terminus compared to isoform A. ##Evidence-Data-START## Transcript exon combination :: AY066015.2, BC064623.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025095 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: C21orf80; FUT13
• Note: Immunogen Sequence Homology: Human: 100%