Antibodies

Jump to Filters
View as table Download
NCOA62 (SNW1) Rabbit Polyclonal Antibody
TA330234

USD 375.00

5 Days

Rabbit Polyclonal Anti-SKIIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE
NCOA62 (SNW1) Rabbit Polyclonal Antibody
TA381853

USD 220.00

3 Weeks

SNW1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-536 of human SNW1 (NP_036377.1).
Modifications Unmodified